SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405306 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405306
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000142
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405306   Gene: ENSG00000236315   Transcript: ENST00000420556
Sequence length 201
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_APD:31567993:31572083:-1 gene:ENSG00000236315 transcript:ENST00000420556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV
VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG
NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV
PAPLPPPCGSSAHLLPPVPGG
Download sequence
Identical sequences O14931
NYSGRC-IgSF-NCTR3_HUMAN ENSP00000342156 ENSP00000372969 ENSP00000389071 ENSP00000390131 ENSP00000398313 ENSP00000405306 ENSP00000416035 ENSP00000416944 9606.ENSP00000342156 9606.ENSP00000372969 9606.ENSP00000389071 9606.ENSP00000390131 9606.ENSP00000398313 9606.ENSP00000405306 9606.ENSP00000416035 9606.ENSP00000416944 ENSP00000342156 ENSP00000372969 ENSP00000389071 ENSP00000390131 ENSP00000398313 ENSP00000405306 ENSP00000416035 ENSP00000416944 gi|24475832|ref|NP_667341.1| ENSP00000342156 ENSP00000372968 ENSP00000389071 ENSP00000389396 ENSP00000395238 ENSP00000399128 ENSP00000404747 ENSP00000405306 NP_667341.1.87134 NP_667341.1.92137 XP_006715112.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]