SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405639 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405639
Domain Number 1 Region: 651-840
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.00000000721
Further Details:      
 
Domain Number 2 Region: 845-985
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-39
Family Pleckstrin-homology domain (PH domain) 0.000000125
Further Details:      
 
Domain Number 3 Region: 331-481
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1084-1140
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000998
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 98-252
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000536
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSP00000405639
Domain Number - Region: 487-582
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0297
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405639   Gene: ENSG00000126217   Transcript: ENST00000423482
Sequence length 1182
Comment pep:known chromosome:GRCh37:13:113656031:113751224:1 gene:ENSG00000126217 transcript:ENST00000423482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVESPVPAARASLTGSCVLGQAMPLRGGAGPSPASHGPTHGPSDPRTCLPGRGAGGMR
PHGRGALGCCGLCSFYTCHGAAGDEIMHQDIVPLCAADIQDQLKKRFAYLSGGRGQDGSP
VITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVKASVLRIA
ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKSQLT
EDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLCA
HTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETE
AAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAHVEHLLRD
LASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARRRGL
LSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQE
LNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPE
ALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEESLAILRR
HVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFHN
RIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQECQRK
LDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILKAVNDSMH
LIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCK
KREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIK
AAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTD
PLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPK
KLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWVPASSLSV
RLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
Download sequence
Identical sequences ENSP00000364754 XP_016875984.1.92137 9606.ENSP00000364754 ENSP00000405639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]