SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406482 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406482
Domain Number 1 Region: 194-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1283-1340
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000811
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 630-694
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 1031-1090
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 360-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000106
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 771-824
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 697-766
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 8 Region: 1414-1469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 1165-1215
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000772
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 1089-1159
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000102
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 1338-1388
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000124
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 12 Region: 902-957
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000068
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 13 Region: 420-494
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000889
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSP00000406482
Domain Number - Region: 1218-1273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00051
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 508-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00327
Family TSP-1 type 1 repeat 0.009
Further Details:      
 
Domain Number - Region: 967-1030
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0314
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406482   Gene: ENSG00000005108   Transcript: ENST00000423059
Sequence length 1657
Comment pep:known chromosome:GRCh37:7:11414170:11871824:-1 gene:ENSG00000005108 transcript:ENST00000423059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQARRWASGSRGAAGPRRGVLQLLPLPLPLPLLLLLLLRPGAGRAAAQGEAEAPTLYL
WKTGPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKE
LYDWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPK
PLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQV
CQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELI
KKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKE
CQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVV
PCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTH
KNKEASKPMDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKL
RKRRITNEPTGGSGVTGNCPHLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQE
VVCINSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQI
RARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTT
TWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKKDCIVTPYSDW
TSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKW
RRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQ
IPCQDDCQLTSWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDK
YNAQPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNS
HGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVN
QAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEGVQTRKVRCMQNTADGPSEH
VEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTQCVLPCNQSSFRQRSADPIRQPADE
GRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVD
LKYCEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQG
DGRPCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFS
KVVDEEFCADIELIIDGNKNMVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGG
IQVRSRPVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWKGSSRTVWCQRSDGIN
VTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVV
LPTMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLI
FIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences Q9UPZ6
ENSP00000406482 9606.ENSP00000406482 ENSP00000406482 ENSP00000406482 gi|150170672|ref|NP_056019.1| NP_056019.1.87134 NP_056019.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]