SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409938 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409938
Domain Number 1 Region: 221-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409938   Gene: ENSG00000101230   Transcript: ENST00000447521
Sequence length 464
Comment pep:known chromosome:GRCh37:20:13251151:13281298:1 gene:ENSG00000101230 transcript:ENST00000447521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETS
FSLSKEAPREHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADING
QNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKY
DSTSDDSNFLNPPRGWDHTAPGHRTFETKDQPEYDSTDGEGDWSLWSVCSVTCGNGNQKR
TRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERW
MSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKDASGPKEKLEI
YKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences B1AKI9 G3QJR0 K7CF09
NP_543016.1.87134 NP_543016.1.92137 XP_004061869.1.27298 XP_016792946.1.37143 gi|153791192|ref|NP_543016.1| ENSGGOP00000002663 9606.ENSP00000262487 ENSP00000262487 ENSP00000262487 ENSGGOP00000002663 ENSP00000409938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]