SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410217 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410217
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-62
Family BAR domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410217   Gene: ENSG00000110934   Transcript: ENST00000452142
Sequence length 565
Comment pep:known chromosome:GRCh37:12:51674823:51717948:-1 gene:ENSG00000110934 transcript:ENST00000452142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKL
YKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQ
AVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
QTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEK
QHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTSPSTLSLKSESESVSATEDLA
PDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSPTTERAKSQEE
VLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP
RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPE
AKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVS
MVPENNNLTAPEPQEEVSTSENPQL
Download sequence
Identical sequences Q9UBW5
ENSP00000410217 ENSP00000267012 ENSP00000267012 gi|49472835|ref|NP_057377.2| 9606.ENSP00000267012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]