SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411193 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411193
Domain Number 1 Region: 46-535
Classification Level Classification E-value
Superfamily Sema domain 2.75e-178
Family Sema domain 0.0000000000783
Further Details:      
 
Domain Number 2 Region: 531-582
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 598-679
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000304
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411193   Gene: ENSG00000075223   Transcript: ENST00000419255
Sequence length 769
Comment pep:known chromosome:GRCh37:7:80374184:80551675:-1 gene:ENSG00000075223 transcript:ENST00000419255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSKKGIFPWILTCISEEMAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTS
EYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECK
MAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESG
KGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPM
FVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTT
FLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHL
SDIQTVFNGPFAHKEGPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIR
NHPLMYNSIYPIHKRPLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVL
PTNNSVSGELILEELEVFKNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACA
DCCLARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYG
VKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYH
CIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEM
QMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences ENSP00000411193 ENSP00000445649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]