SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412292 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412292
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-26
Family DEP domain 0.027
Further Details:      
 
Domain Number 2 Region: 228-300,587-682
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000644
Family BCR-homology GTPase activation domain (BH-domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412292   Gene: ENSG00000024526   Transcript: ENST00000456315
Sequence length 811
Comment pep:known chromosome:GRCh37:1:68939835:68962797:-1 gene:ENSG00000024526 transcript:ENST00000456315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNN
SNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYP
ELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRE
LSQEDVEEVWRYVILIYLQTILGVPSLEEVINPKQVIPQYIMYNMANTSKRGVVILQNKS
DDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIADYFLDLPEPLLTFEYYELFV
NILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLLHREKNKEESD
STERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC
CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFS
AGFKRTSTLTVQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQ
GSTSVQTAMESELGESSATINKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAID
ALQLCCLLLPPPNRRKLQLLMRMISRMSQNVDMPKLHDAMGTRSLMIHTFSRCVLCCAEE
VDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYLKKGHIENPGDGLFAPLPTYS
YCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKEYPLIYQKRFP
TTESEAALFGDKPTIKQPMLILRKPKFRSLR
Download sequence
Identical sequences Q5TB30
gi|166295188|ref|NP_001107592.1| 9606.ENSP00000412292 ENSP00000412292 ENSP00000412292 NP_001107592.1.87134 NP_001107592.1.92137 ENSP00000412292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]