SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414272 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414272
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 8.63e-34
Family Spectrin repeat 0.000000652
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-22
Family Spectrin repeat 0.00000238
Further Details:      
 
Domain Number 6 Region: 740-828,868-926
Classification Level Classification E-value
Superfamily EF-hand 1.8e-18
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414272   Gene: ENSG00000072110   Transcript: ENST00000438964
Sequence length 930
Comment pep:known chromosome:GRCh37:14:69341403:69445979:-1 gene:ENSG00000072110 transcript:ENST00000438964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGY
NMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKLQEGG
KMQTAHAAFTPPGFAAVSGRAALRLLDFAAFLTTLSSQNYITMDELRRELPPDQAEYCIA
RMAPYTGPDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences ENSP00000439828 ENSP00000414272 ENSP00000439828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]