SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414822 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414822
Domain Number 1 Region: 264-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414822   Gene: ENSG00000124143   Transcript: ENST00000414158
Sequence length 622
Comment pep:putative chromosome:GRCh37:20:37275706:37279678:1 gene:ENSG00000124143 transcript:ENST00000414158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQLPQKNLLRLHPAGSAGCSTGVESSSMDGFWMEVEQIQQRDELREEDSGGNEGQLPEE
GEAESQWLQDTGLSGLLGGLGLDGDHQELLSTLTQTQVAAVCRRLDIYARSVRRQHKTPV
RDVRDVFGVFNSGKMSSENGDSGMKGAQLSSGASKFPPAAEPGGLQEQAGREEAFNMDSA
YSEQAAVLLQRSRPSRGGTSAWGKCSLPKFTVPKGRLGVTRIGDLSLQDMRKVPSLALIE
LTALCDILGLDLKRSKAGKWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLSCLE
KRGLDMEGILRVPGSQARVKGLEQKLERDFYAGLFSWDEVHHNDASDLLKRFIRKLPTPL
LTAEYLPAFAVVPNIPNLKQRLQVLHLLILILPEPNRNALKALLEFLRKVVAREQHNKMT
LRNVSTVMAPNLFLHQGRPPKLPKGKEKQLAEGAAEVVQIMVHYQDLLWTVASFLVAQVR
KLNDSSSRRPQLCDAGLKTWLRRMHADRDKAGDGLEATPKVAKIQVVWPIKDPLKVPLTP
STKVAHVLRQFTEHLSPGSKGQEDSEDMDSLLLHHRSMESANILLYEVGGNINEHRLDPD
AYLLDLYRANPHGEWVLKQNPT
Download sequence
Identical sequences Q5TG30
ENSP00000362442 ENSP00000362442 ENSP00000414822 9606.ENSP00000362442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]