SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416545 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416545
Domain Number 1 Region: 38-132
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.84e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 230-376
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-25
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 133-240
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416545   Gene: ENSG00000105963   Transcript: ENST00000453823
Sequence length 385
Comment pep:putative chromosome:GRCh37:7:940170:967150:-1 gene:ENSG00000105963 transcript:ENST00000453823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQFVFSRVYCINPARRKWKEFEKMLGCAEEGHASLGRDPDWASYTLGVFICLSCSGIHR
NIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWI
RAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAK
EPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAAR
FHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPL
DAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVA
AFQKAVDRPMLPQEYAVEAHFKHKP
Download sequence
Identical sequences ENSP00000442682 ENSP00000416545 ENSP00000442682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]