SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417517 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417517
Domain Number 1 Region: 629-921
Classification Level Classification E-value
Superfamily L domain-like 3.06e-48
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 2 Region: 187-584
Classification Level Classification E-value
Superfamily L domain-like 6.32e-39
Family Ngr ectodomain-like 0.009
Further Details:      
 
Domain Number 3 Region: 29-152
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.25e-29
Family Cofilin-like 0.0014
Further Details:      
 
Domain Number 4 Region: 1016-1171
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-26
Family Toll/Interleukin receptor TIR domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417517   Gene: ENSG00000173366   Transcript: ENST00000494383
Sequence length 1186
Comment pep:putative chromosome:GRCh37:3:52255097:52265206:-1 gene:ENSG00000173366 transcript:ENST00000494383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVN
YIQMKLDLERETIELVHTEPTDVAQLPSRVPRDAARYHFFLYKHTHEGDPLESVVFIYSM
PGYKCSIKERMLYSSCKSRLLDSVEQDFHLEIAKKGFCRSALHPLSLLVQAIMLAMTLAL
GTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHL
PSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLI
SLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSL
KYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCM
ECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITK
TKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIFFRSLDETTLRP
LARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKV
WLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHN
CISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGH
NFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSLRALDFSGNALGHMWAEGDLYLHFFQG
LSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHFLPKLEVLDLAG
NQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFG
PLASALQILDVSANPLHCACGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDL
RLCLDEALSWDCFALSLLAVALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRDED
ALPYDAFVVFDKTQSAVADWVYNELRGQLEECRGRWALRLCLEERDWLPGKTLFENLWAS
VYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRYVRLRQR
LCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE
Download sequence
Identical sequences H0Y858
ENSP00000417517 ENSP00000417517 ENSP00000417517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]