SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417521 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417521
Domain Number 1 Region: 290-498
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.54e-58
Family Reprolysin-like 0.00069
Further Details:      
 
Domain Number 2 Region: 586-642
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000706
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 1107-1165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000602
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1183-1239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 1380-1439
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000824
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1049-1108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 1553-1612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 993-1053
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 1234-1295
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 1444-1498
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 1327-1383
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000929
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 1615-1675
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 13 Region: 1679-1727
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 14 Region: 1496-1554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 15 Region: 877-932
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000759
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSP00000417521
Domain Number - Region: 938-993
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0101
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417521   Gene: ENSG00000163638   Transcript: ENST00000481060
Sequence length 1935
Comment pep:known chromosome:GRCh37:3:64507157:64601826:-1 gene:ENSG00000163638 transcript:ENST00000481060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTR
ARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTC
SRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFDGK
HFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDICV
QGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNID
VRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKR
KLVCTRESDQLTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDI
YCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRR
RAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQ
FGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYM
SVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK
GTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSAS
PSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACES
GPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACP
HDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPK
WKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWR
AEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGE
WSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCK
EVKRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNP
TECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATA
GDCYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCG
KCTPSSGTGLEVRVL
Download sequence
Identical sequences Q9P2N4
9606.ENSP00000418735 ENSP00000418735 gi|33624896|ref|NP_891550.1| ENSP00000417521 NP_891550.1.87134 NP_891550.1.92137 ENSP00000418735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]