SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417570 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417570
Domain Number 1 Region: 165-613
Classification Level Classification E-value
Superfamily Sema domain 1.24e-143
Family Sema domain 0.0000000813
Further Details:      
 
Domain Number 2 Region: 904-961
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000353
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 718-768
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000102
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 961-1018
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 609-658
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000082
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 772-824
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 7 Region: 1019-1063
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000798
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSP00000417570
Domain Number - Region: 663-715
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417570   Gene: ENSG00000082684   Transcript: ENST00000475244
Sequence length 1205
Comment pep:known chromosome:GRCh37:3:122628041:122747452:-1 gene:ENSG00000082684 transcript:ENST00000475244 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWMPCGFS
PSPVAHHLVPGPPDTPAQQLRCGWTVGGWLLSLVRGLLPCLPPGARTAEGPIMVLAGPLA
VSLLLPSLTLLVSHLSSSQDVSSEPSSEQQLCALSKHPTVAFEDLQPWVSNFTYPGARDF
SQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNYV
RVLIVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGE
LYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAYFFLRENAV
EHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSAFHLP
EQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCG
TLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLY
HVLYIGTESGTILKALSTASRSLHGCYLEELHVLPPGRREPLRSLRILHSARALFVGLRD
GVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNV
TRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGA
WTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIFWA
SWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVN
VTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGS
TSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQA
CPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQACPE
GWSPWSEWSKCTDDGAQSRSRHCEELLPGSSACAGNSSQSRPCPYSEIPVILPASSMEEA
TDCAGFNLIHLVATGISCFLGSGLLTLAVYLSCQHCQRQSQESTLVHPATPNHLHYKGGG
TPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQR
CFPNS
Download sequence
Identical sequences NP_001243276.1.87134 NP_001243276.1.92137 ENSP00000389588 ENSP00000389588 ENSP00000417570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]