SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422663 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422663
Domain Number 1 Region: 164-365
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000892
Further Details:      
 
Domain Number 2 Region: 33-146,183-208
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-31
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSP00000422663
Domain Number - Region: 628-694
Classification Level Classification E-value
Superfamily Tropomyosin 0.000222
Family Tropomyosin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422663   Gene: ENSG00000128805   Transcript: ENST00000460425
Sequence length 714
Comment pep:known chromosome:GRCh37:10:49654601:49864310:-1 gene:ENSG00000128805 transcript:ENST00000460425 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGTARRSHAHPLEPLPPGIFGQRLEETVHHE
RKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDV
HTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLL
RYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRK
HSQLFTAPVPEGPTSPRGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVL
SRTAPTGPGSRCSPGKKVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNG
LSSLRGHRRASSGDRLKDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGG
SLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSE
PDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEEELDQ
EKKKYIMLEIKLRNSERAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK
Download sequence
Identical sequences ENSP00000412461 ENSP00000422663 ENSP00000412461 NP_001242953.1.87134 NP_001242953.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]