SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422716 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000422716
Domain Number - Region: 109-201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422716   Gene: ENSG00000181392   Transcript: ENST00000490730
Sequence length 404
Comment pep:putative chromosome:GRCh37:19:36494212:36499695:-1 gene:ENSG00000181392 transcript:ENST00000490730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSLPLGPRLGSEPLNHPPGAPREADIVGCTVCPASGEESTSPEQAQTLGQDSLGPPEH
FQGGPRGNEPAAHPPRWSTPSSYEDPAGGKHCEHPISGLEVLEAEQNSLHLCLLGLGRRL
QDLEQGLGHWALAQSGMVQLQALQVDLRGAAERVEALLAFGEGLAQRSEPRAWAALEQIL
RALGAYRDSIFRRLWQLQAQLVSYSLVFEEANTLDQDLEVEGDSDWPGPGGVWGPWAPSS
LPTSTELEWDPAGDIGGLGPLGQKTARTLGVPCELCGQRGPQGRGQGLEEADTSHSRQDM
LESGLGHQKRLARHQRHSLLRKPQDKKRQASPHLQDVRLEGNPGAPDPASRQPLTFLLIL
FLLFLLLVGAMFLLPASGGPCCSHARIPRTPYLVLSYVNGLPPV
Download sequence
Identical sequences Q8N205
gi|89886475|ref|NP_001034965.1| 9606.ENSP00000316130 NP_001034965.1.87134 NP_001034965.1.92137 ENSP00000422716 ENSP00000316130 ENSP00000316130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]