SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426236 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426236
Domain Number 1 Region: 91-306
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-84
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 324-446
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-32
Family Spectrin repeat 0.000000786
Further Details:      
 
Domain Number 3 Region: 560-681
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-29
Family Spectrin repeat 0.00000514
Further Details:      
 
Domain Number 4 Region: 448-555
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-24
Family Spectrin repeat 0.00000311
Further Details:      
 
Domain Number 5 Region: 789-916
Classification Level Classification E-value
Superfamily EF-hand 1.77e-21
Family Calmodulin-like 0.072
Further Details:      
 
Domain Number 6 Region: 685-796
Classification Level Classification E-value
Superfamily Spectrin repeat 1.49e-19
Family Spectrin repeat 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426236   Gene: ENSG00000248746   Transcript: ENST00000511191
Sequence length 944
Comment pep:known chromosome:GRCh37:11:66314386:66322032:1 gene:ENSG00000248746 transcript:ENST00000511191 gene_biotype:polymorphic_pseudogene transcript_biotype:nonsense_mediated_decay
Sequence
MGIGLCVPPARCWKRLTRSSRGQPLERPAATIIIGLSIVERSKQTQRGPVDFSRSHSAPA
AEQECKPRISAARSTPAPPSPAVPGFRTTPCQTFTAWCNSHLRKAGTQIENIEEDFRNGL
KLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMT
LGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALI
HRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVS
CFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTVPWLENRVGE
PSMSAMQRKLEDFRDYRRLHKPPRIQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSD
IANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFRQKASLHEAWTRGKEEMLSQRDYD
SALLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQW
DNLGTLTQKRRDALERMEKLLETIDRLQLEFARRAAPFNNWLDGAVEDLQDVWLVHSVEE
TQSLLTAHDQFKATLPEADXERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK
WDMVRKLVPSCDQTLQEELARQQVNERLRRQFAAQANAIGPWIQAKVEEVGRLAAGLAGS
LEEQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTS
IARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLG
EVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTTEQVVASFKILAGDKNYITPEEL
RRELPAKQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESDL
Download sequence
Identical sequences ENSP00000426236 ENSP00000422007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]