SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427084 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427084
Domain Number 1 Region: 98-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427084   Gene: ENSG00000164107   Transcript: ENST00000503024
Sequence length 217
Comment pep:known chromosome:GRCh37:4:174446120:174450063:-1 gene:ENSG00000164107 transcript:ENST00000503024 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSM
ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA
ELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEK
RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences A0A0D9S255 A0A1A6H617 A0A1D5QY03 A0A1S2ZQN8 A0A1U7QB47 A0A286Y4K2 A0A2J8R9C8 A0A2K5NYJ7 A0A2K5WR18 A0A2K6ELB9 A0A2K6KDJ9 H2R7W4 I3N8C3 P61295 P61296 Q61039
ENSSTOP00000020619 HR4599 10090.ENSMUSP00000044983 9544.ENSMMUP00000024678 9598.ENSPTRP00000050916 9606.ENSP00000352565 ENSSTOP00000020619 ENSP00000427084 ENSMUSP00000044983 NP_034532.3.92730 NP_068808.1.87134 NP_068808.1.92137 NP_073187.1.100692 NP_073187.1.4139 XP_001085842.1.72884 XP_003469175.1.53824 XP_004278730.1.21590 XP_004320282.2.83887 XP_004395297.1.74151 XP_004433554.1.5094 XP_005075208.1.91757 XP_005325569.1.77405 XP_005368142.1.66349 XP_005556373.1.63531 XP_006751371.1.47382 XP_006864581.1.41390 XP_006882275.1.29581 XP_006970989.1.50099 XP_007523068.1.11023 XP_007998469.1.81039 XP_008153462.1.99482 XP_008845360.1.79516 XP_009446856.1.37143 XP_010971477.1.22495 XP_010993323.1.51371 XP_011941760.1.92194 XP_012507103.1.63892 XP_012626135.2.48125 XP_014697625.1.49734 XP_015341693.1.40921 XP_017711445.1.44346 XP_019491655.1.44202 XP_020009981.1.5219 XP_021074956.1.100879 XP_021554635.1.83697 ENSMUSP00000044983 ENSMUSP00000044983 ENSPTRP00000050916 ENSP00000352565 ENSP00000352565 ENSMMUP00000024678 ENSMMUP00000024678 gi|12545384|ref|NP_068808.1| ENSPTRP00000050916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]