SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427296 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427296
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-61
Family FCH domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000427296
Domain Number - Region: 655-788
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000562
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427296   Gene: ENSG00000157107   Transcript: ENST00000512348
Sequence length 810
Comment pep:novel chromosome:GRCh37:5:72251896:72384255:1 gene:ENSG00000157107 transcript:ENST00000512348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSA
SNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVA
GTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLY
VEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFIN
NMANTTVESLIQKFAESKGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEK
DAESVECPDADSLNIPDVDEEGYSIKPETNQNDTKENHFYSSSDSDSEDEEPKKYRIEIK
PMHPNNSHHTMASLDELKVSIGNITLSPAISVSTNTRLNRNFNDEELTKSKPSAPPNEKG
TSDLLAWDPLFGPSLDSSSSSSLTSSSSARPTTPLSVGTIVPPPRPASRPKLTSGKLSGI
NEIPRPFSPPVTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVSLGNQ
DTLPVAVALTESVNAYFKGADPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAVLCFRVKN
ISRLEQILPNAQLVFSDPSQCDSNTKDFWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQ
VSSNGIQSTPLNLATYWKCSASTTDLRVDYKYNPEAMVAPSVLSNIQVVVPVDGGVTNMQ
SLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGSTL
SGVDFELVGTGYRLSLIKKRFATGRYLADC
Download sequence
Identical sequences ENSP00000427296 ENSP00000344034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]