SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432044 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432044
Domain Number 1 Region: 66-272
Classification Level Classification E-value
Superfamily ARM repeat 0.000000015
Family Diap1 N-terninal region-like 0.083
Further Details:      
 
Weak hits

Sequence:  ENSP00000432044
Domain Number - Region: 263-411
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0549
Family p120GAP domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432044   Gene: ENSG00000166788   Transcript: ENST00000530436
Sequence length 476
Comment pep:putative chromosome:GRCh37:11:18101892:18111821:-1 gene:ENSG00000166788 transcript:ENST00000530436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPENTKSSSDDEE
QLTELDEEMENEICRVWDMSMDEDVALFLQEFNAPDIFMGVLAKSKCPRLREICVGILGN
MACFQEICVSISSDKNLGQVLLHCLYDSDPPTLLETSRLLLTCLSQAEVASVWVERIQEH
PAIYDSICFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWVRNGAAQPLDQPQEESEEQ
PVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDGIQAIVHCPDTGKDIWNLLFD
LVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKGKYNLPLIDSLIR
VLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQ
GVKEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT
Download sequence
Identical sequences E9PRZ1
ENSP00000432216 ENSP00000432216 ENSP00000432044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]