SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440243 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000440243
Domain Number - Region: 346-377
Classification Level Classification E-value
Superfamily UBA-like 0.000953
Family UBA domain 0.032
Further Details:      
 
Domain Number - Region: 250-298
Classification Level Classification E-value
Superfamily UBA-like 0.00536
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440243   Gene: ENSG00000246922   Transcript: ENST00000502113
Sequence length 381
Comment pep:known chromosome:GRCh37:15:65385344:65398697:-1 gene:ENSG00000246922 transcript:ENST00000502113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNALDGVPFKLPKGFVIGTEPLPGPELSVPACGEVLLGSMHDFSLERTALFWVEAAGQGP
SPYQCGDPGTASAPPAWLLLVSPEHGLAPAPTTIRDPEAGHQERPEEEGEDEAEASSGSE
EEPAPSSLQPGSPASPGPGRRLCSLDVLRGVRLELAGARRRLSEGKLVSRPRALLHGLRG
HRALSLCPSPAQSPRSASPPGPAPQHPAAPASPPRPSTAGAIPPLRSHKPTVASLSPYTC
LPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVVALGYPLRRAIIALQKTGRQS
LSQFLSYLSACDRLLRQGYEEGLVDEAMEMFQFSESQAGEFLRLWEQFSDMGFQQDRIKE
VLLVHGNRREQALEELVACAQ
Download sequence
Identical sequences F5GYI3
ENSP00000440243 NP_001157164.1.87134 NP_001157164.1.92137 ENSP00000440243 ENSP00000454012 gi|254939613|ref|NP_001157164.1| ENSP00000440243 ENSP00000454012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]