SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000444797 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444797
Domain Number 1 Region: 93-204,314-429,471-492,541-630
Classification Level Classification E-value
Superfamily RNI-like 2.9e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 
Domain Number 2 Region: 13-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000294
Family F-box domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444797   Gene: ENSG00000155034   Transcript: ENST00000453700
Sequence length 801
Comment pep:known chromosome:GRCh37:7:5528994:5553423:-1 gene:ENSG00000155034 transcript:ENST00000453700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLA
ALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRS
LVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTL
FTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPG
YINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKS
WLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPD
SLLRKAEDDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLARLRHLRSLSL
PVCSVADSAPRADRAPAQPAMHAVPRGFGKKVRVGVQSCPSPFSGQACPQPSSVFWSLLK
NLPFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDSEVAAIGQLAFLRHLTLAQ
LPSVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLEQPYF
SANAQFFQALSQCPSLQRLCLVSRSGTLQPDAVLAFMARCLQVVMCHLFTGESLATCKSL
QQSLLRRWGEVTGRRPQLFTELREEPSARTSRATGRRQPCLPDSGVVCCPCGRPLAVSGI
ILVGVSPSLVVKTTCVYRVLFKNLDYASIFFLVCLFETESHSVVQAGVQWRDLSSLQPLL
SGLQPQPPEQLGLQVCTTIPG
Download sequence
Identical sequences NP_001308142.1.87134 NP_001308142.1.92137 ENSP00000444797 ENSP00000444797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]