SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446205 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446205
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446205   Gene: ENSG00000179111   Transcript: ENST00000541682
Sequence length 230
Comment pep:known chromosome:GRCh37:17:8023908:8027402:-1 gene:ENSG00000179111 transcript:ENST00000541682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPAAAAPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAAR
AQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAW
SPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
Download sequence
Identical sequences ENSP00000446205 ENSP00000446205 ENSP00000446205 NP_001159439.1.87134 NP_001159439.1.92137 gi|260166650|ref|NP_001159439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]