SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446550 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446550
Domain Number 1 Region: 666-859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000405
Further Details:      
 
Domain Number 2 Region: 471-598
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-18
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Domain Number 3 Region: 17-87
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000493
Family SH3-domain 0.002
Further Details:      
 
Domain Number 4 Region: 244-279
Classification Level Classification E-value
Superfamily WW domain 0.0000000191
Family WW domain 0.0026
Further Details:      
 
Domain Number 5 Region: 294-330
Classification Level Classification E-value
Superfamily WW domain 0.0000196
Family WW domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSP00000446550
Domain Number - Region: 387-415
Classification Level Classification E-value
Superfamily WW domain 0.0097
Family WW domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446550   Gene: ENSG00000257961   Transcript: ENST00000546802
Sequence length 862
Comment pep:known chromosome:GRCh37:HSCHR17_1:43471268:43502999:-1 gene:ENSG00000257961 transcript:ENST00000546802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADVVGDVYVLVEHPFEYTGKDGRRVAIRPNERYRLLRRSTEHWWHVRREPGGRPFYLP
AQYVRELPALGNPAAAAPPGPHPSPAAPEPLAYDYRFVSAAATAGPDGAPEESGGRTSSL
CGPAQRGAATQRSSLAPGLPACLYLRPAAPVRPAQSLNDLACAAVSPPAGLLGSSGSFKA
CSVAGSWVCPRPLARSDSENVYEVIQDLHVPPREESAEQVDDPPEPVYANIERQPRATSP
GAAAAPLPSPVWETHTDAGTGRPYYYNPDTGVTTWESPFEAAEGAASPATSPASVDSHVS
LETEWGQYWDEESRRVFFYNPLTGETAWEDEAENEPEEELEMQPGLSPGSPGDPRPPTPE
TDYPESLTSYPEEDYSPVGSFGEPGPTSPLTTPPGWSCHVSQDKQMLYTNHFTQEQVPVP
APRSIHKSSQDGDTPAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTK
TADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLS
WAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSR
VDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREK
GYIKDQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYK
VDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRSRCV
RDLVRSLPAPNHDTLRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMPMT
MVFQNQVVELILQQCADIFPPH
Download sequence
Identical sequences ENSP00000446550 ENSP00000447150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]