SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447520 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447520
Domain Number 1 Region: 6-308
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.74e-59
Family BAR domain 0.000000265
Further Details:      
 
Domain Number 2 Region: 284-379
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-23
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 478-619
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-21
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447520   Gene: ENSG00000136044   Transcript: ENST00000549056
Sequence length 670
Comment pep:putative chromosome:GRCh37:12:105605067:105623638:-1 gene:ENSG00000136044 transcript:ENST00000549056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFRE
KDLTEVSTLKDLFGLASNDVCLFLEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQ
HLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQ
SIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVT
TTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGII
LQAESRKENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPS
QNLKNSEMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPF
GETEDESFPEAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTE
SHLMVTSQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTY
IFESNSEGEKICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNP
NEHRGAESEA
Download sequence
Identical sequences G3RBH7
ENSP00000446917 NP_001238833.1.87134 NP_001238833.1.92137 XP_004053850.2.27298 ENSP00000446917 ENSP00000447520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]