SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448510 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448510
Domain Number 1 Region: 262-612
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-85
Family p120GAP domain-like 0.0000334
Further Details:      
 
Domain Number 2 Region: 568-710
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-33
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 3 Region: 113-253
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-29
Family Synaptotagmin-like (S variant) 0.0057
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.2e-26
Family PLC-like (P variant) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448510   Gene: ENSG00000111344   Transcript: ENST00000548055
Sequence length 806
Comment pep:novel chromosome:GRCh37:12:113537692:113573309:-1 gene:ENSG00000111344 transcript:ENST00000548055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRSLGPFWGEEYTVH
LPLDFHQLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEI
CLSVQMLEDGQGRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLETSTIKKTRFPHW
DEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVEFSPKTLQQKPPKGWFRLLPFPRAE
EDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESVQGPAEEDTASPLALLEELTLGD
CRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLASKSMEQFMKLVGM
PYLHEVLKPVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMRETSLGLLTGYLG
PIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQQDVKYLAISGFLFLRFFAPAIL
TPKLFDLRDQHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQCVSRVR
DFLDRLVDVDGDEEAGVPARALFPPSAIVREGYLLKRKEEPAGLATRFAFKKRYVWLSGE
TLSFSKSPEWQMCHSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGTGALHTTYLQCKNVN
ELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDWSD
PLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLARQRAATARLLEV
LADLDRAHEEFQQQERGKAALGPLGP
Download sequence
Identical sequences ENSP00000450244 gi|302058252|ref|NP_001180449.1| ENSP00000448510 NP_001180449.1.87134 NP_001180449.1.92137 XP_005254007.1.92137 XP_006719704.1.92137 XP_011537154.1.92137 ENSP00000450244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]