SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452237 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452237
Domain Number 1 Region: 335-412
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.63e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000309
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000452237
Domain Number - Region: 229-335
Classification Level Classification E-value
Superfamily Prefoldin 0.000235
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 143-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000523
Family Intermediate filament protein, coiled coil region 0.0075
Further Details:      
 
Domain Number - Region: 7-101,422-486
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452237   Gene: ENSG00000258832   Transcript: ENST00000553310
Sequence length 486
Comment pep:known chromosome:GRCh37:12:52668459:52702598:1 gene:ENSG00000258832 transcript:ENST00000553310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCG
GSCKRC
Download sequence
Identical sequences O43790
gi|14318422|ref|NP_002275.1| ENSP00000293525 ENSP00000444533 ENSP00000293525 ENSP00000452237 NP_001307127.1.87134 NP_001307127.1.92137 XP_016874785.1.92137 ENSP00000293525 ENSP00000443169 ENSP00000444533 9606.ENSP00000293525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]