SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457512 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457512
Domain Number 1 Region: 256-325
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000441
Family IBR domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 173-238
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000051
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 336-408
Classification Level Classification E-value
Superfamily RING/U-box 0.00000494
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 4 Region: 49-88
Classification Level Classification E-value
Superfamily UBA-like 0.0000464
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457512   Gene: ENSG00000259529   Transcript: ENST00000558468
Sequence length 547
Comment pep:known chromosome:GRCh37:14:24620427:24636611:1 gene:ENSG00000259529 transcript:ENST00000558468 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
SELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQS
LGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVR
RLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWA
LPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTL
DIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFC
VRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGC
MHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKL
LQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEY
LVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQ
SIPRRRK
Download sequence
Identical sequences A0A0B4J293
ENSP00000457512 ENSP00000457512 ENSP00000457512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]