SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457628 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457628
Domain Number 1 Region: 93-186
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-21
Family Ubiquitin-related 0.00000723
Further Details:      
 
Domain Number 2 Region: 490-566
Classification Level Classification E-value
Superfamily UBA-like 4.82e-19
Family UBA domain 0.0001
Further Details:      
 
Domain Number 3 Region: 374-441
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000901
Family UBA domain 0.013
Further Details:      
 
Domain Number 4 Region: 458-496
Classification Level Classification E-value
Superfamily UBA-like 0.00000292
Family UBA domain 0.027
Further Details:      
 
Domain Number 5 Region: 260-413
Classification Level Classification E-value
Superfamily TPR-like 0.00000621
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457628   Gene: ENSG00000013374   Transcript: ENST00000566856
Sequence length 639
Comment pep:known chromosome:GRCh37:7:151038858:151075530:1 gene:ENSG00000013374 transcript:ENST00000566856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNGGRCRIRALCWSRREWRGAGMAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGL
ALKDLAKQYSDRLECCENEVEKVIEEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKD
RKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVL
ELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIA
NQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDT
VDNYAVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEK
VLFLRLYLLQGIRNYHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLG
LRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAA
SGNLDEALKILLSNPQMWWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRVFR
GNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEIL
EDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKKN
Download sequence
Identical sequences H3BM74
ENSP00000454264 NP_001230280.1.87134 NP_001230280.1.92137 ENSP00000457628 ENSP00000454264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]