SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458256 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458256
Domain Number 1 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-21
Family I set domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458256   Gene: ENSG00000262346   Transcript: ENST00000576622
Sequence length 236
Comment pep:known chromosome:GRCh37:HSCHR19LRC_LRC_T_CTG1:54544083:54567207:-1 gene:ENSG00000262346 transcript:ENST00000576622 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVL
RKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDK
HDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPE
QEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKV
Download sequence
Identical sequences Q6UX27
NP_940883.2.87134 NP_940883.2.92137 gi|145580634|ref|NP_940883.2| 9606.ENSP00000343366 ENSP00000343366 ENSP00000475048 ENSP00000476281 ENSP00000476450 ENSP00000476578 ENSP00000476850 ENSP00000476967 ENSP00000477030 ENSP00000477193 ENSP00000477385 ENSP00000343366 ENSP00000458211 ENSP00000458256 ENSP00000458271 ENSP00000458395 ENSP00000458580 ENSP00000458853 ENSP00000459336 ENSP00000459364 ENSP00000343366 ENSP00000478582 ENSP00000480533 ENSP00000480547 ENSP00000482197 ENSP00000482555 ENSP00000482985 ENSP00000483412 ENSP00000484806 ENSP00000484844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]