SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458481 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458481
Domain Number 1 Region: 327-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.55e-21
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 2 Region: 87-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000256
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSP00000458481
Domain Number - Region: 143-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0186
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458481   Gene: ENSG00000262845   Transcript: ENST00000576064
Sequence length 431
Comment pep:known chromosome:GRCh37:HSCHR17_4_CTG4:39134095:39143380:-1 gene:ENSG00000262845 transcript:ENST00000576064 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLL
PCYFTGSCNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESR
IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES
ELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLREQLGD
RLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQG
CQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAE
IRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA
YVICTVENCCL
Download sequence
Identical sequences Q6A162
NP_872303.2.87134 NP_872303.2.92137 ENSP00000366984 ENSP00000381500 ENSP00000459621 ENSP00000479080 ENSP00000366984 ENSP00000458481 NYSGRC-125490370 gi|125490370|ref|NP_872303.2| 9606.ENSP00000366984 ENSP00000366984 ENSP00000381500 ENSP00000459621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]