SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460236 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460236
Domain Number 1 Region: 610-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000366
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 554-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000523
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 665-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 501-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000902
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 754-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 443-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000732
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460236   Gene: ENSG00000262655   Transcript: ENST00000576479
Sequence length 807
Comment pep:known chromosome:GRCh37:HG256_PATCH:13984236:14289351:1 gene:ENSG00000262655 transcript:ENST00000576479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSPAPLKLSRTPALLALALPLAAALAFSDETLDKVPKSEGYCSRILRAQGTRREGYTE
FSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEEDHAGTFQIIDEE
ETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKK
LCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHS
KNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAA
PSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSG
VTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPD
NVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPC
PDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTL
PTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKKRHRMIKMNPADGSMCKAETS
QAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNEDLEQVEKC
MLPECPIDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRKKCRIRKC
LRNPSIQKLRWREARESRRSEQLKEESEGEQFPGCRMRPWTAWSECTKLCGGGIQERYMT
VKKRFKSSQFTSCKDKKEIRACNVHPC
Download sequence
Identical sequences Q9HCB6
ENSP00000460236 ENSP00000460236 gi|110347423|ref|NP_006099.2| NP_006099.2.87134 NP_006099.2.92137 ENSP00000460236 HR5351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]