SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465752 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465752
Domain Number 1 Region: 81-369
Classification Level Classification E-value
Superfamily ARM repeat 1.77e-28
Family Armadillo repeat 0.052
Further Details:      
 
Domain Number 2 Region: 366-448
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.16e-18
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 524-645
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000262
Family Toll/Interleukin receptor TIR domain 0.0066
Further Details:      
 
Domain Number 4 Region: 449-511
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000164
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465752   Gene: ENSG00000267556   Transcript: ENST00000589014
Sequence length 690
Comment pep:known chromosome:GRCh37:HG883_PATCH:26711845:26715413:1 gene:ENSG00000267556 transcript:ENST00000589014 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGAVARAHGGLRVARARESVAGGRHRGAGRPGARAAGAAAGLVRAEAGGRRAGRGRRPGR
GLPTGGGGLAAAAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVA
ENRDRVARIGLGVILNLAKEREPVELARSGSGILEHMFKHSEETCQRLVAAGGLDAVLYW
CRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLSLHACLAV
AVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLL
DSNRLEAQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRAL
RLLGEEVPRPILPSVPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTD
LGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSL
LHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGS
QLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHD
CKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEK
IIRFLQGRSSRDSSAGSDTSLEGAAPMGPT
Download sequence
Identical sequences ENSP00000406738 ENSP00000466426 ENSP00000406738 ENSP00000465752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]