SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466308 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466308
Domain Number 1 Region: 29-523
Classification Level Classification E-value
Superfamily Sema domain 1.96e-178
Family Sema domain 0.000000000012
Further Details:      
 
Domain Number 2 Region: 520-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000419
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 585-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000225
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466308   Gene: ENSG00000262015   Transcript: ENST00000586936
Sequence length 754
Comment pep:putative chromosome:GRCh37:HG325_PATCH:50310551:50314597:1 gene:ENSG00000262015 transcript:ENST00000586936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLV
DEERGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNRTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLRPFPAEDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPF
AHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPT
GGRPLFLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLL
LEELHVFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCA
WDGVACTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPR
SLQARVEWTFQRAGVTAHTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQPL
RRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPA
LQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW
Download sequence
Identical sequences A0A0C4DGV8
ENSP00000465436 ENSP00000466308 ENSP00000480680 NP_001276990.1.87134 NP_001276990.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]