SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466485 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466485
Domain Number 1 Region: 140-220
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000169
Family Rna1p (RanGAP1), N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466485   Gene: ENSG00000105341   Transcript: ENST00000589970
Sequence length 263
Comment pep:novel chromosome:GRCh37:19:41937777:41945813:-1 gene:ENSG00000105341 transcript:ENST00000589970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDLVLEDRRMNSLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEA
LRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHF
SQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLAD
SLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGV
DWAEGLKSGPEEQPRDTASPVPA
Download sequence
Identical sequences gi|268830752|ref|NP_001161339.1| ENSP00000466485 ENSP00000403910 ENSP00000477321 NP_001161339.1.87134 NP_001161339.1.92137 ENSP00000403910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]