SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000005082 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000005082
Domain Number 1 Region: 419-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 531-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.46e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 239-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000256
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000398
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 295-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000183
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 210-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000446
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000005082   Gene: ENSG00000005801   Transcript: ENST00000005082
Sequence length 629
Comment pep:known chromosome:GRCh37:11:3380224:3400346:-1 gene:ENSG00000005801 transcript:ENST00000005082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRK
EPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSV
DKFTALCSPGVLQTVKWFLEFRCIFSLAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGL
DNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTG
EKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEPENIDTGEKPY
KCQECNNVIKTCSVLTKNRIYAGGEHYRCEEFGKVFNQCSHLTEHEHGTEEKPCKYEECS
SVFISCSSLSNQQMILAGEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCEECDSIFK
WFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSS
LSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVH
KRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIH
TGEKPYKCEKCGKAFTQFSHLTVHESIHT
Download sequence
Identical sequences O14628
NP_001123992.1.87134 NP_001123992.1.92137 9606.ENSP00000005082 ENSP00000382511 ENSP00000005082 gi|194473688|ref|NP_001123992.1| ENSP00000382511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]