SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000196489 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000196489
Domain Number 1 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 503-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 391-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 23-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 544-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000286
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000335
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000196489   Gene: ENSG00000083817   Transcript: ENST00000196489
Sequence length 594
Comment pep:known chromosome:GRCh37:19:58082935:58090243:-1 gene:ENSG00000083817 transcript:ENST00000196489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLRDSTSVPVTAEAKLMGFTQGCVTFEDVAIYFSQEEWGLLDEAQRLLYRDVMLEN
FALITALVCWHGMEDEETPEQSVSVEGVPQVRTPEASPSTQKIQSCDMCVPFLTDILHLT
DLPGQELYLTGACAVFHQDQKHHSAEKPLESDMDKASFVQCCLFHESGMPFTSSEVGKDF
LAPLGILQPQAIANYEKPNKISKCEEAFHVGISHYKWSQCRRESSHKHTFFHPRVCTGKR
LYESSKCGKACCCECSLVQLQRVHPGERPYECSECGKSFSQTSHLNDHRRIHTGERPYVC
GQCGKSFSQRATLIKHHRVHTGERPYECGECGKSFSQSSNLIEHCRIHTGERPYECDECG
KAFGSKSTLVRHQRTHTGEKPYECGECGKLFRQSFSLVVHQRIHTTARPYECGQCGKSFS
LKCGLIQHQLIHSGARPFECDECGKSFSQRTTLNKHHKVHTAERPYVCGECGKAFMFKSK
LVRHQRTHTGERPFECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQH
QVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV
Download sequence
Identical sequences Q9BWM5
ENSP00000196489 NP_060349.1.87134 NP_060349.1.92137 gi|33859678|ref|NP_060349.1| ENSP00000196489 ENSP00000196489 9606.ENSP00000196489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]