SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000228741 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000228741
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-47
Family ets domain 0.00000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000228741   Gene: ENSG00000111145   Transcript: ENST00000228741
Sequence length 407
Comment pep:known chromosome:GRCh37:12:96588160:96663613:1 gene:ENSG00000111145 transcript:ENST00000228741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGRE
AHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVR
TVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPNAASISSASPFS
SRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGSKTKSPSLPPKAKKPKGLEIS
APPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS
Download sequence
Identical sequences A0A024RBE2 P41970
NP_005221.2.87134 NP_005221.2.92137 XP_006719338.1.92137 ENSP00000228741 9606.ENSP00000228741 ENSP00000228741 gi|44955921|ref|NP_005221.2| ENSP00000228741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]