SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000236914 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000236914
Domain Number 1 Region: 152-166,301-539
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-67
Family Nuclear receptor ligand-binding domain 0.00000000273
Further Details:      
 
Domain Number 2 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000236914   Gene: ENSG00000116833   Transcript: ENST00000236914
Sequence length 541
Comment pep:known chromosome:GRCh37:1:199996742:200144731:1 gene:ENSG00000116833 transcript:ENST00000236914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Download sequence
Identical sequences G3R3Z2 H2N494 H2Q0V0 O00482
ENSGGOP00000009977 ENSP00000356331 ENSPTRP00000003036 gi|45545405|ref|NP_995582.1| ENSPTRP00000003036 ENSPPYP00000000425 IGBMC-1017-000 ENSP00000236914 ENSP00000356331 ENSGGOP00000009977 9598.ENSPTRP00000003036 9600.ENSPPYP00000000425 9606.ENSP00000356331 ENSPPYP00000000425 NP_995582.1.87134 NP_995582.1.92137 XP_001142695.1.37143 XP_003823109.1.60992 XP_004028157.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]