SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000248211 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000248211
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-24
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-21
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 7 Region: 511-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000209
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 213-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000607
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000248211   Gene: ENSG00000256223   Transcript: ENST00000248211
Sequence length 573
Comment pep:known chromosome:GRCh37:12:133707178:133736051:1 gene:ENSG00000256223 transcript:ENST00000248211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLV
LREYFHKRDSHTKSLKHDLVLNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKC
PDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVH
SSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQ
RIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHT
GEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
Download sequence
Identical sequences G2HH24 P21506
ENSP00000248211 ENSP00000393814 ENSP00000248211 ENSP00000393814 NP_001233376.1.37143 NP_056209.2.87134 NP_056209.2.92137 XP_008965587.1.60992 XP_008965588.1.60992 XP_008965589.1.60992 XP_009424894.1.37143 XP_014202859.1.60992 XP_014202860.1.60992 XP_014202861.1.60992 XP_016777992.1.37143 XP_016777993.1.37143 XP_016777994.1.37143 XP_016777995.1.37143 XP_016777996.1.37143 XP_016777997.1.37143 XP_016777998.1.37143 9598.ENSPTRP00000009624 ENSP00000248211 gi|21314662|ref|NP_056209.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]