SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000248980 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000248980
Domain Number 1 Region: 178-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-58
Family SPRY domain 0.00000107
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000353
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000248980   Gene: ENSG00000128253   Transcript: ENST00000248980
Sequence length 378
Comment pep:known chromosome:GRCh37:22:32586422:32589466:-1 gene:ENSG00000128253 transcript:ENST00000248980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTN
KRPSCAPSPQDLSAQWKQLEDRGASSRRVDMAALFQEASSCPVCSDYLEKPMSLECGCAV
CLKCINSLQKEPHGEDLLCCCSSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPR
MRKFQVDMTLDANTANNFLLISDDLRSVRSGRIRQNRQDLAERFDVSVCILGSPRFTCGR
HCWEVDVGTSTEWDLGVCRESVHRKGRIQLTTELGFWTVSLRDGGRLSATTVPLTFLFVD
RKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSIC
PLMNSGTTDAPVRPGEAK
Download sequence
Identical sequences O75678
ENSP00000248980 NP_001091997.2.87134 NP_001091997.2.92137 XP_011528134.1.92137 ENSP00000248983 ENSP00000383096 gi|227116303|ref|NP_001091997.2| ENSP00000383096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]