SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000251269 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000251269
Domain Number 1 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 23-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-20
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 543-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-16
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000015
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000251269   Gene: ENSG00000159905   Transcript: ENST00000251269
Sequence length 617
Comment pep:known chromosome:GRCh37:19:44455397:44471861:1 gene:ENSG00000159905 transcript:ENST00000251269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPSLELLHSGLCKFPEVEGKMTTFKEAVTFKDVAVVFTEEELGLLDPAQRKLYRDVML
ENFRNLLSVGNQPFHQDTFHFLGKEKFWKMKTTSQREGNSGGKIQIEMETVPEAGPHEEW
SCQQIWEQIASDLTRSQNSIRNSSQFFKEGDVPCQIEARLSISHVQQKPYRCNECKQSFS
DVSVFDLHQQSHSGEKSHTCGECGKSFCYSPALHIHQRVHMGEKCYKCDVCGKEFNQSSH
LQTHQRVHTGEKPFKCGQCGKGFHSRSALNVHCKLHTGEKPYNCEECGKAFIHDSQLQEH
QRIHTGEKPFKCDICGKSFRVRSRLNRHSMVHTGEKAFRCDTCGKNFRQRSALNSHSMVH
IEEKPYKCEQCGKGFICRRDFCKHQMVHTGEKPYNCKECGKTFRWSSCLLNHQQVHSGQK
SFKCEECGKGFYTNSRRSSHQRSHNGEKPYNCEECGKDYKRRLDLEFHQRVHTGERPYNC
KECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQSSQLHSHQTCHTGEKLYKCEQCE
KGYNSKFNLDMHQRVHGGERPYNCKECGKSFGWASCLLKHQRLHSGEKPLKSGVWEEIYS
EFTASFTSVSLCGRKAI
Download sequence
Identical sequences ENSP00000251269 ENSP00000251269 ENSP00000467367 ENSP00000467446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]