SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000251643 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000251643
Domain Number 1 Region: 357-435
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 123-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSP00000251643
Domain Number - Region: 239-355
Classification Level Classification E-value
Superfamily Prefoldin 0.00575
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000251643   Gene: ENSG00000187242   Transcript: ENST00000251643
Sequence length 494
Comment pep:known chromosome:GRCh37:17:39017555:39023462:-1 gene:ENSG00000187242 transcript:ENST00000251643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAA
SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL
LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY
PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD
ELTLTRTDLEMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND
MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQ
SQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKA
RLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNG
EVVSSQVQEIEELM
Download sequence
Identical sequences Q99456
NYSGRC-4557699 ENSP00000251643 ENSP00000459559 NP_000214.1.87134 NP_000214.1.92137 ENSP00000251643 ENSP00000459559 9606.ENSP00000251643 gi|4557699|ref|NP_000214.1| ENSP00000251643 ENSP00000459559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]