SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000254101 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000254101
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily AMPKBI-like 5.86e-36
Family AMPKBI-like 0.00000434
Further Details:      
 
Domain Number 2 Region: 76-156
Classification Level Classification E-value
Superfamily E set domains 5.28e-27
Family AMPK-beta glycogen binding domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000254101   Gene: ENSG00000131791   Transcript: ENST00000254101
Sequence length 272
Comment pep:known chromosome:GRCh37:1:146626685:146644123:-1 gene:ENSG00000131791 transcript:ENST00000254101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences G3SCS5 O43741
NP_005390.1.87134 NP_005390.1.92137 XP_004026557.1.27298 XP_018877100.1.27298 XP_018877104.1.27298 ENSP00000254101 ENSP00000463518 ENSGGOP00000025903 GO.33898 HR13 9606.ENSP00000254101 ENSP00000254101 ENSP00000463518 ENSP00000254101 ENSGGOP00000025903 gi|4885561|ref|NP_005390.1| 6b2e_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]