SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000256261 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000256261
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-47
Family Dual specificity phosphatase-like 0.0000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000256261   Gene: ENSG00000133878   Transcript: ENST00000256261
Sequence length 211
Comment pep:known chromosome:GRCh37:8:33448856:33457624:-1 gene:ENSG00000133878 transcript:ENST00000256261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences A0A0D9RTB9 A0A2I3HXT4 A0A2K5K1B3 A0A2K6MG73 A0A2K6NRP4 H2QW05 Q9BV47
ENSNLEP00000014720 ENSPTRP00000034500 gi|13128968|ref|NP_076930.1| NYSGXRC-8685a ENSP00000256261 ENSNLEP00000014720 9598.ENSPTRP00000034500 9606.ENSP00000256261 ENSPTRP00000034500 NP_001292044.1.87134 NP_001292044.1.92137 NP_001292045.1.87134 NP_001292045.1.92137 NP_076930.1.87134 NP_076930.1.92137 XP_001169283.1.37143 XP_003269614.1.23891 XP_003830794.1.60992 XP_007960343.1.81039 XP_007960344.1.81039 XP_008954418.1.60992 XP_009453445.1.37143 XP_010370495.1.97406 XP_010370496.1.97406 XP_010370497.1.97406 XP_011816114.1.43180 XP_017712923.1.44346 XP_017712930.1.44346 ENSP00000256261 ENSP00000429176 ENSP00000256261 ENSP00000429176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]