SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261332 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261332
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.66e-39
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 287-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 4 Region: 333-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000221
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261332   Gene: ENSG00000172466   Transcript: ENST00000261332
Sequence length 368
Comment pep:known chromosome:GRCh37:18:32912176:32924420:-1 gene:ENSG00000172466 transcript:ENST00000261332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
Download sequence
Identical sequences P17028
ENSP00000261332 ENSP00000382015 ENSP00000261332 ENSP00000382015 9606.ENSP00000261332 ENSP00000261332 gi|190610012|ref|NP_008896.2| NP_008896.2.87134 NP_008896.2.92137 XP_005258398.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]