SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262085 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262085
Domain Number 1 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 600-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 194-244
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000144
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSP00000262085
Domain Number - Region: 403-443
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000183
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262085   Gene: ENSG00000170265   Transcript: ENST00000262085
Sequence length 671
Comment pep:known chromosome:GRCh37:7:148892577:148923339:1 gene:ENSG00000170265 transcript:ENST00000262085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNF
WVLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLDAE
GSVPKPDAPVQAEPREEPCVWEQRHPEEREIPMDPEAGAEPLVPAQDASSQVKREDTLCV
RGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIPTDPNSESLIS
AHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQPQPPQPQ
LQSQPQPQSLPPIAVAENPGGPPSRGLLDDGFQVLPGERGSGEAPPGGDRSTGGGGGDGG
GGGGGAEAGTGAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSH
TKERPYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGER
PFQCALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGA
PRQLPPPPERD
Download sequence
Identical sequences A0A090N8Y3 Q9UDV7
gi|31657109|ref|NP_003566.1| 9606.ENSP00000262085 ENSP00000262085 ENSP00000477841 NP_003566.1.87134 NP_003566.1.92137 ENSP00000262085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]