SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262428 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262428
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.86e-43
Family Cofilin-like 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262428   Gene: ENSG00000103187   Transcript: ENST00000262428
Sequence length 142
Comment pep:known chromosome:GRCh37:16:84599200:84651683:-1 gene:ENSG00000103187 transcript:ENST00000262428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE
Download sequence
Identical sequences H2RA06 Q14019
9606.ENSP00000262428 gi|21624607|ref|NP_066972.1| NP_066972.1.87134 NP_066972.1.92137 XP_016785780.1.37143 ENSP00000262428 ENSP00000262428 ENSP00000262428 d1wnja1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]