SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262554 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262554
Domain Number 1 Region: 58-469
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.83e-82
Family GABA-aminotransferase-like 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262554   Gene: ENSG00000090054   Transcript: ENST00000262554
Sequence length 473
Comment pep:known chromosome:GRCh37:9:94794281:94877658:-1 gene:ENSG00000090054 transcript:ENST00000262554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI
DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
Download sequence
Identical sequences A0A024R277 O15269
9606.ENSP00000262554 gi|5454084|ref|NP_006406.1| ENSP00000262554 NP_006406.1.87134 NP_006406.1.92137 ENSP00000262554 ENSP00000262554 Hs5454084___KOG1358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]