SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000263388 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000263388
Domain Number 1 Region: 1779-2024
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 798-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000115
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1109-1250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 570-699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000046
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 5 Region: 388-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000137
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 507-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000979
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 7 Region: 236-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000102
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 920-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000102
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 10 Region: 1080-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 198-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 12 Region: 274-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 13 Region: 1338-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000005
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 1001-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000657
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1467-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 16 Region: 1248-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000275
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 42-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.038
Further Details:      
 
Domain Number 20 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 735-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 962-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000619
Family EGF-type module 0.01
Further Details:      
 
Domain Number 23 Region: 1386-1418
Classification Level Classification E-value
Superfamily Notch domain 0.00000101
Family Notch domain 0.0014
Further Details:      
 
Domain Number 24 Region: 1426-1458
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 25 Region: 1048-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000411
Family EGF-type module 0.04
Further Details:      
 
Domain Number 26 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 27 Region: 773-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.023
Further Details:      
 
Domain Number 28 Region: 80-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000263388
Domain Number - Region: 1291-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0179
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000263388   Gene: ENSG00000074181   Transcript: ENST00000263388
Sequence length 2321
Comment pep:known chromosome:GRCh37:19:15270445:15311792:-1 gene:ENSG00000074181 transcript:ENST00000263388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences Q9UM47
ENSP00000263388 ENSP00000263388 gi|134244285|ref|NP_000426.2| ENSP00000263388 NP_000426.2.87134 NP_000426.2.92137 9606.ENSP00000263388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]