SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000265174 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265174
Domain Number 1 Region: 395-618
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.19e-75
Family ATP sulfurylase catalytic domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 225-392
Classification Level Classification E-value
Superfamily PUA domain-like 1.39e-52
Family ATP sulfurylase N-terminal domain 0.0000000237
Further Details:      
 
Domain Number 3 Region: 34-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265174   Gene: ENSG00000138801   Transcript: ENST00000265174
Sequence length 624
Comment pep:known chromosome:GRCh37:4:108534822:108641608:-1 gene:ENSG00000138801 transcript:ENST00000265174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPS
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWTVLTEYYKSLEKA
Download sequence
Identical sequences A0A2I3HQ83 K7CTZ2 O43252
ENSNLEP00000015796 ENSP00000265174 ENSP00000265174 NP_005434.4.87134 NP_005434.4.92137 XP_003257787.1.23891 9606.ENSP00000265174 ENSP00000265174 gi|46094058|ref|NP_005434.4| ENSNLEP00000015796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]